PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim07g054380.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family HD-ZIP
Protein Properties Length: 208aa    MW: 23593 Da    PI: 10.1933
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim07g054380.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.98.2e-1967121256
                         T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         rk+ ++tkeq + Le+ F+++ ++   +++eLA+kl+L+ rqV vWFqNrRa+ k
  Sopim07g054380.0.1  67 RKKLRLTKEQSTLLEDSFKQHTTLAMGQKQELAAKLKLKPRQVEVWFQNRRARTK 121
                         678899***********************************************98 PP

2HD-ZIP_I/II113.99.7e-3767155189
         HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                         +kk+rl+keq++lLE+sF+++++L   +K+ela +L+l+prqv+vWFqnrRARtk+kq+E+d+e++k+++++l++en+rL+ke +eLr+
  Sopim07g054380.0.1  67 RKKLRLTKEQSTLLEDSFKQHTTLAMGQKQELAAKLKLKPRQVEVWFQNRRARTKLKQTEVDCEFMKKWCQSLNDENNRLKKELQELRS 155
                         69*************************************************************************************94 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.2E-1845124IPR009057Homeodomain-like
SuperFamilySSF466897.7E-1857124IPR009057Homeodomain-like
PROSITE profilePS5007116.60163123IPR001356Homeobox domain
SMARTSM003891.6E-1565127IPR001356Homeobox domain
PfamPF000463.8E-1667121IPR001356Homeobox domain
CDDcd000861.64E-1367124No hitNo description
PROSITE patternPS00027098121IPR017970Homeobox, conserved site
PfamPF021832.3E-9123155IPR003106Leucine zipper, homeobox-associated
SMARTSM003408.3E-17123166IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 208 aa     Download sequence    Send to blast
MGNNSNEACD TRLTLGLATS DHHKKKITCL DLSIIPLHDT SKIDGSSSKT CKNYTKFNSE  60
SKKIGMRKKL RLTKEQSTLL EDSFKQHTTL AMGQKQELAA KLKLKPRQVE VWFQNRRART  120
KLKQTEVDCE FMKKWCQSLN DENNRLKKEL QELRSIKIDQ RAPTPTPFHL SKTRTLALCS  180
SCQKISGGDT DEKHETGLDD GLSKRAN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1115123RRARTKLKQ
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755191e-153HG975519.1 Solanum lycopersicum chromosome ch07, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004243806.11e-152PREDICTED: homeobox-leucine zipper protein HAT22-like
SwissprotA2XE767e-47HOX19_ORYSI; Homeobox-leucine zipper protein HOX19
SwissprotQ8GRL47e-47HOX19_ORYSJ; Homeobox-leucine zipper protein HOX19
TrEMBLK4CFY31e-152K4CFY3_SOLLC; Uncharacterized protein
STRINGSolyc07g054380.1.11e-151(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29024186
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.12e-43HD-ZIP family protein